Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuropeptide W-30 (human) serves as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It acts as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8, binding and activating them at comparable effective doses [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | Neuropeptide W-30 (human) serves as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It acts as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8, binding and activating them at comparable effective doses [1] [2] [3]. |
Synonyms | NPW30, human |
Molecular Weight | 3543.11 |
Formula | C165H249N49O37S |
Cas No. | 383415-80-3 |
Sequence | Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp |
Sequence Short | WYKHVASPRYHTVGRAAGLLMGLRRSPYLW |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.