Your shopping cart is currently empty

Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2]. |
| In vitro | Melanostatin, a frog compound at 1 μM concentration, enhances potassium current while reducing sodium and calcium currents, leading to hyperpolarization of the cell membrane [1]. |
| Molecular Weight | 4243.67 |
| Formula | C189H285N53O57S |
| Cas No. | 134709-16-3 |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.