Shopping Cart
- Remove All
- Your shopping cart is currently empty
Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2]. |
In vitro | Melanostatin, a frog compound at 1 μM concentration, enhances potassium current while reducing sodium and calcium currents, leading to hyperpolarization of the cell membrane [1]. |
Molecular Weight | 4243.67 |
Formula | C189H285N53O57S |
Cas No. | 134709-16-3 |
Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Lys-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Sequence Short | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2 |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.