Shopping Cart
Remove All
Your shopping cart is currently empty
Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitor of Kv1.3 (Kd = 11.7 pM). It also inhibits Kv1.2 (Kd = 6.4 pM) and Kv1.1 (Kd = 4.2 nM), making it a valuable tool for ion channel research [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitor of Kv1.3 (Kd = 11.7 pM). It also inhibits Kv1.2 (Kd = 6.4 pM) and Kv1.1 (Kd = 4.2 nM), making it a valuable tool for ion channel research [1] [2]. |
| In vivo | In 12-week-old C57BL/6J mice, Margatoxin TFA (ip; 1 pmol/g) significantly reduced thioglycollate-induced peritoneal leukocyte migration [2]. |
| Molecular Weight | 4178.95 (free base) |
| Formula | C178H286N52O50S7.xC2HF3O2 |
| Sequence | Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36) |
| Sequence Short | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.