Your shopping cart is currently empty

M1-20 is a CDK1 inhibitor. It promotes the ubiquitination of CDK1 through the CUL4-DDB1-DCAF1 complex, leading to its degradation via the proteasome pathway. M1-20 inhibits the formation of the CDK1/CCNB1 complex and exhibits significant anticancer activity against spontaneous breast cancer in the FVB/N MMTV-PyVT mouse model.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | M1-20 is a CDK1 inhibitor. It promotes the ubiquitination of CDK1 through the CUL4-DDB1-DCAF1 complex, leading to its degradation via the proteasome pathway. M1-20 inhibits the formation of the CDK1/CCNB1 complex and exhibits significant anticancer activity against spontaneous breast cancer in the FVB/N MMTV-PyVT mouse model. |
| Sequence | d{Gly-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Leu-Gly-Pro-Phe-Ser-Ile-Asp-Leu-Leu-Ile-Lys-Ser-Leu-Ser-Asp-Asn-Met-Thr-Asp-Leu} |
| Sequence Short | d{GRRRQRRKKRLGPFSIDLLIKSLSDNMTDL} |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.