Your shopping cart is currently empty

LEAP-2 (Human liver expressed antimicrobial peptide-2) is an antimicrobial peptide and an endogenous competitive antagonist of growth hormone-releasing peptide, as well as a reverse agonist of constitutive GHS-R1a activity, used for research on obesity and other metabolic diseases.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $177 | Inquiry | Inquiry |
| Description | LEAP-2 (Human liver expressed antimicrobial peptide-2) is an antimicrobial peptide and an endogenous competitive antagonist of growth hormone-releasing peptide, as well as a reverse agonist of constitutive GHS-R1a activity, used for research on obesity and other metabolic diseases. |
| In vivo | Pretreatment with LEAP-2 (0.3, 1, 3 nmol/ rat, ICV) inhibited auxin peptide-induced food intake in rats in a dose-dependent manner at 12 h in a free-feeding state. [2] |
| Synonyms | Human liver expressed antimicrobial peptide-2 |
| Cas No. | 1683582-94-6 |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Short | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: 80 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.