Shopping Cart
Remove All
Your shopping cart is currently empty
LEAP-2 (Human liver expressed antimicrobial peptide-2) is an antimicrobial peptide and an endogenous competitive antagonist of growth hormone-releasing peptide, as well as a reverse agonist of constitutive GHS-R1a activity, used for research on obesity and other metabolic diseases.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $177 | Inquiry | Inquiry |
| Description | LEAP-2 (Human liver expressed antimicrobial peptide-2) is an antimicrobial peptide and an endogenous competitive antagonist of growth hormone-releasing peptide, as well as a reverse agonist of constitutive GHS-R1a activity, used for research on obesity and other metabolic diseases. |
| In vivo | Pretreatment with LEAP-2 (0.3, 1, 3 nmol/ rat, ICV) inhibited auxin peptide-induced food intake in rats in a dose-dependent manner at 12 h in a free-feeding state. [2] |
| Synonyms | Human liver expressed antimicrobial peptide-2 |
| Cas No. | 1683582-94-6 |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Short | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: 80 mg/mL, Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.