Your shopping cart is currently empty

LEAP-2 acetate (Human liver expressed antimicrobial peptide-2) is an endogenous antagonist of the ghrelin receptor GHS-R1a with an IC50 of 6.0 nM, suppressing the orexigenic effects of ghrelin, attenuating ghrelin-induced growth hormone release, reducing basal food intake. LEAP-2 acetateexhibit direct antimicrobial activity against model microorganisms, thereby serving as a multifunctional peptide for mechanistic studies of obesity, metabolism, and infection biology.

| Description | LEAP-2 acetate (Human liver expressed antimicrobial peptide-2) is an endogenous antagonist of the ghrelin receptor GHS-R1a with an IC50 of 6.0 nM, suppressing the orexigenic effects of ghrelin, attenuating ghrelin-induced growth hormone release, reducing basal food intake. LEAP-2 acetateexhibit direct antimicrobial activity against model microorganisms, thereby serving as a multifunctional peptide for mechanistic studies of obesity, metabolism, and infection biology. |
| Targets&IC50 | GHSR1a:1-3 nM (Ki) |
| In vivo | In metabolic mouse models, LEAP-2 acetate functions as a satiety signal. Its plasma levels are inversely correlated with Ghrelin; levels decrease during fasting and rise upon re-feeding. Administration of LEAP-2 acetate suppresses appetite and prevents Ghrelin-induced hyperglycemia by blocking the reduction of insulin secretion. In diet-induced obese mice, chronic administration or overexpression of LEAP-2 acetate leads to reduced food intake and body weight loss [1]. |
| Synonyms | LEAP-2 acetate (1683582-94-6 Free base), Human liver expressed antimicrobial peptide-2 acetate |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Short | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.