Shopping Cart
Remove All
Your shopping cart is currently empty
LEAP-2 acetate
🥰Excellent
Catalog No. T81944L
Alias LEAP-2 acetate （1683582-94-6 Free base）, Human liver expressed antimicrobial peptide-2 acetate
LEAP-2 acetate (Human liver expressed antimicrobial peptide-2) is an endogenous antagonist of the ghrelin receptor GHS-R1a with an IC50 of 6.0 nM, suppressing the orexigenic effects of ghrelin, attenuating ghrelin-induced growth hormone release, reducing basal food intake. LEAP-2 acetateexhibit direct antimicrobial activity against model microorganisms, thereby serving as a multifunctional peptide for mechanistic studies of obesity, metabolism, and infection biology.
LEAP-2 acetate
LEAP-2 acetate
🥰Excellent
Catalog No. T81944LAlias LEAP-2 acetate （1683582-94-6 Free base）, Human liver expressed antimicrobial peptide-2 acetate
LEAP-2 acetate (Human liver expressed antimicrobial peptide-2) is an endogenous antagonist of the ghrelin receptor GHS-R1a with an IC50 of 6.0 nM, suppressing the orexigenic effects of ghrelin, attenuating ghrelin-induced growth hormone release, reducing basal food intake. LEAP-2 acetateexhibit direct antimicrobial activity against model microorganisms, thereby serving as a multifunctional peptide for mechanistic studies of obesity, metabolism, and infection biology.
Product information is being updated, if you want to purchase, please click the bulk custom button.
Add to Quotation
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | LEAP-2 acetate (Human liver expressed antimicrobial peptide-2) is an endogenous antagonist of the ghrelin receptor GHS-R1a with an IC50 of 6.0 nM, suppressing the orexigenic effects of ghrelin, attenuating ghrelin-induced growth hormone release, reducing basal food intake. LEAP-2 acetateexhibit direct antimicrobial activity against model microorganisms, thereby serving as a multifunctional peptide for mechanistic studies of obesity, metabolism, and infection biology. |
| Targets&IC50 | GHSR1a:1-3 nM (Ki) |
| Synonyms | LEAP-2 acetate （1683582-94-6 Free base）, Human liver expressed antimicrobial peptide-2 acetate |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Short | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Storage | keep away from moisture | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . A total of 10 animals were administered, and the formula you used is 5% 
DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。Stock solution preparation method: 2 mg of drug dissolved in 50 μL DMSO (stock solution concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
(stock solution concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.Preparation method for in vivo formula: Take 50 μL DMSO main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarify
main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarifyThe above example illustrates how to use "In Vivo Formulation Calculator" and does not represent a recommended formulation for any specific compound. Please select an appropriate dissolution method based on your experimental animals and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy LEAP-2 acetate | purchase LEAP-2 acetate | LEAP-2 acetate cost | order LEAP-2 acetate
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.