Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | JNJ63955918 is a potent and highly selective peptide that acts as a closed-state blocker of Nav1.7, exhibiting an IC50 of 8.0 nM. This compound is suitable for research in pain studies. |
| Targets & IC50 | Nav1.7 (human):8.0 nM |
| Sequence | Gly-Pro-Tyr-Cys-Gln-Lys-Trp-Met-Gln-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Leu (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys27) |
| Sequence Short | GPYCQKWMQTCDSERKCCEGMVCRLWCKKKLL |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.