Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific inhibitor of the Kv4.1 channel, exhibiting an IC50 of 0.363 μM. It interacts with the channel by altering gating behavior.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin-XII (JzTx-XII) TFA is a specific inhibitor of the Kv4.1 channel, exhibiting an IC50 of 0.363 μM. It interacts with the channel by altering gating behavior. |
Synonyms | JzTx-XII TFA |
Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Glu-Leu-Trp-Cys-Lys-Tyr-Asn-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
Sequence Short | YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.