Shopping Cart
- Remove All
- Your shopping cart is currently empty
Selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50 values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50 = >10 μM). Inhibits the channel by binding at the neurotoxin receptor site 4 in the S3-S4 linker of domain II, trapping the voltage sensor in the inward, closed configuration.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $614 | Backorder |
Description | Selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50 values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50 = >10 μM). Inhibits the channel by binding at the neurotoxin receptor site 4 in the S3-S4 linker of domain II, trapping the voltage sensor in the inward, closed configuration. |
Targets&IC50 | Nav1.7:26 nM, Nav1.4:400 nM, Nav1.3:338 nM, Nav1.2:150 nM |
Synonyms | Huwentoxin IV |
Molecular Weight | 4106.79 |
Formula | C174H278N52O51S6 |
Cas No. | 526224-73-7 |
Relative Density. | no data available |
Sequence | Glu-Cys-Leu-Glu-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
Sequence Short | ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.24 mM) |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.