Shopping Cart
- Remove All
- Your shopping cart is currently empty
Hongotoxin-1, a chemical compound isolated from the venom of Centruroides limbatus, functions as a potassium channel inhibitor. It exhibits inhibitory concentrations (IC50) for potassium channel subtypes Kv1.1, Kv1.2, Kv1.3, and Kv1.6 at 31 pM, 170 pM, 86 pM, and 6000 pM, respectively [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Hongotoxin-1, a chemical compound isolated from the venom of Centruroides limbatus, functions as a potassium channel inhibitor. It exhibits inhibitory concentrations (IC50) for potassium channel subtypes Kv1.1, Kv1.2, Kv1.3, and Kv1.6 at 31 pM, 170 pM, 86 pM, and 6000 pM, respectively [1]. |
Targets&IC50 | Kv1.1:31 pM, Kv1.2:170 pM, Kv1.3:86 pM, Kv1.6:6000 pM |
Molecular Weight | 4226.13 |
Formula | C181H299N53O49S7 |
Sequence | Thr-Val-Ile-Asp-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Ile-Arg-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32) |
Sequence Short | TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.