Shopping Cart
- Remove All
- Your shopping cart is currently empty
Heteropodatoxin-2, a 30-amino acid peptide, inhibits the Kv4.2 current in Xenopus laevis oocytes through a voltage-dependent mechanism, exhibiting reduced blocking at more positive potentials [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Heteropodatoxin-2, a 30-amino acid peptide, inhibits the Kv4.2 current in Xenopus laevis oocytes through a voltage-dependent mechanism, exhibiting reduced blocking at more positive potentials [1]. |
Molecular Weight | 3412.81 |
Formula | C144H207N39O46S6 |
Cas No. | 741730-12-1 |
Sequence | Asp-Asp-Cys-Gly-Lys-Leu-Phe-Ser-Gly-Cys-Asp-Thr-Asn-Ala-Asp-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Arg-Leu-Trp-Cys-Lys-Leu-Asp-Trp-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26) |
Sequence Short | DDCGKLFSGCDTNADCCEGYVCRLWCKLDW-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.