Shopping Cart
- Remove All
- Your shopping cart is currently empty
HBA(111-142), a C-terminal 32-mer fragment of alpha-hemoglobin, exhibits antibacterial activity against the ESKAPE panel of pathogens, forms amyloid fibrils, and possesses antiviral activities, notably inhibiting the measles virus and herpes viruses (HSV-1, HSV-2, HCMV) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | HBA(111-142), a C-terminal 32-mer fragment of alpha-hemoglobin, exhibits antibacterial activity against the ESKAPE panel of pathogens, forms amyloid fibrils, and possesses antiviral activities, notably inhibiting the measles virus and herpes viruses (HSV-1, HSV-2, HCMV) [1]. |
Molecular Weight | 3428.89 |
Formula | C157H247N41O45 |
Sequence | Ala-Ala-His-Leu-Pro-Ala-Glu-Phe-Thr-Pro-Ala-Val-His-Ala-Ser-Leu-Asp-Lys-Phe-Leu-Ala-Ser-Val-Ser-Thr-Val-Leu-Thr-Ser-Lys-Tyr-Arg |
Sequence Short | AAHLPAEFTPAVHASLDKFLASVSTVLTSKYR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.