Shopping Cart
- Remove All
- Your shopping cart is currently empty
GLP-2(1-33) (human) is an enteroendocrine hormone that stimulates intestinal epithelium growth.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $1,380 | 35 days |
Description | GLP-2(1-33) (human) is an enteroendocrine hormone that stimulates intestinal epithelium growth. |
Synonyms | Glucagon-like peptide 2 (human), GLP-2 (human) |
Molecular Weight | 3766.19 |
Formula | C165H254N44O55S |
Cas No. | 223460-79-5 |
Relative Density. | no data available |
Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Sequence Short | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.