Shopping Cart
- Remove All
- Your shopping cart is currently empty
Gastric Inhibitory Polypeptide (1-30), porcine, deficient in the 12 C-terminal amino acids of the natural gastric inhibitory polypeptide (GIP), demonstrates biological activity by enhancing the release of insulin and somatostatin [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Gastric Inhibitory Polypeptide (1-30), porcine, deficient in the 12 C-terminal amino acids of the natural gastric inhibitory polypeptide (GIP), demonstrates biological activity by enhancing the release of insulin and somatostatin [1]. |
Molecular Weight | 3551.97 |
Formula | C162H244N40O48S |
Cas No. | 134875-67-5 |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.