Shopping Cart
- Remove All
- Your shopping cart is currently empty
Elafin, also referred to as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a protein that serves as a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3, particularly in the lung. Additionally, Elafin exhibits antibacterial properties against Pseudomonas aeruginosa and Staphylococcus aureus [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Elafin, also referred to as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a protein that serves as a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3, particularly in the lung. Additionally, Elafin exhibits antibacterial properties against Pseudomonas aeruginosa and Staphylococcus aureus [1] [2] [3]. |
Molecular Weight | 5999.11 |
Formula | C254H416N72O75S10 |
Sequence | Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln (Disulfide bridge:Cys16- Cy |
Sequence Short | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disulfide bridge:Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.