Shopping Cart
- Remove All
- Your shopping cart is currently empty
Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more.
Description | Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more. |
In vitro | Defensin HNP-1, human acetate (2.5 μg/mL for 48 h) inhibits the growth of human ovarian cancer cell line SKOV3 and induces apoptosis, likely through cell cycle arrest and activation of pro-apoptotic proteins such as caspase-3. Defensin HNP-1, human acetate has also been shown to sensitize cancer cells to chemotherapeutic agents like paclitaxel[1]. |
In vivo | In vivo, in a xenograft model using nude mice (subcutaneous SKOV3 tumors), Defensin HNP-1, human acetate (10 μg/mouse, intraperitoneally, three times per week for 3 weeks) significantly suppressed tumor volume compared to control (P<0.05)[1]. |
Alias | Defensin HNP-1, human acetate(99287-08-8 Free base) |
Molecular Weight | 3508.13 |
Formula | C152H232N44O40S6 |
Smiles | OC(C)=O.OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H]([C@H](O)C)NC(CNC([C@@H](NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(O)=O)NC(CNC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H](C)NC([C@H]2N(CCC2)C([C@H]([C@@H](C)CC)NC([C@H](CCCNC(N)=N)NC([C@H](CS)NC([C@@H](NC([C@H](CS)NC([C@@H](N)C)=O)=O)CC3=CC=C(C=C3)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC4=CC=C(C=C4)O)=O)=O)=O)=O)=O)C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N[C@@H](CS)C(N[C@@H](CS)C(O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)CC6=CNC7=CC=CC=C67)=O)=O)=O)=O)=O |
Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Sequence Short | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Storage | keep away from moisture | store at -20°C | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.