Defensin HNP-1, human acetate

Name: Defensin HNP-1, human acetate
Brand: TargetMol
SKU: T41135L
Rating: 4.5 (1 reviews)

🥰Excellent

Catalog No. T41135L

Alias Defensin HNP-1, human acetate（99287-08-8 Free base）

Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more.

Defensin HNP-1, human acetate

🥰Excellent

Catalog No. T41135LAlias Defensin HNP-1, human acetate（99287-08-8 Free base）

Product information is being updated, if you want to purchase, please click the bulk custom button.

Add to Quotation

Questions

Resource Download

Product Introduction

Bioactivity

Description	Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more.
In vitro	Defensin HNP-1, human acetate (2.5 μg/mL for 48 h) inhibits the growth of human ovarian cancer cell line SKOV3 and induces apoptosis, likely through cell cycle arrest and activation of pro-apoptotic proteins such as caspase-3. Defensin HNP-1, human acetate has also been shown to sensitize cancer cells to chemotherapeutic agents like paclitaxel[1].
In vivo	In vivo, in a xenograft model using nude mice (subcutaneous SKOV3 tumors), Defensin HNP-1, human acetate (10 μg/mouse, intraperitoneally, three times per week for 3 weeks) significantly suppressed tumor volume compared to control (P<0.05)[1].
Synonyms	Defensin HNP-1, human acetate（99287-08-8 Free base）

Chemical Properties

Molecular Weight	3508.13
Formula	C₁₅₂H₂₃₂N₄₄O₄₀S₆
Smiles	OC(C)=O.OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H]([C@H](O)C)NC(CNC([C@@H](NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(O)=O)NC(CNC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H](C)NC([C@H]2N(CCC2)C([C@H]([C@@H](C)CC)NC([C@H](CCCNC(N)=N)NC([C@H](CS)NC([C@@H](NC([C@H](CS)NC([C@@H](N)C)=O)=O)CC3=CC=C(C=C3)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC4=CC=C(C=C4)O)=O)=O)=O)=O)=O)C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N[C@@H](CS)C(N[C@@H](CS)C(O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)CC6=CNC7=CC=CC=C67)=O)=O)=O)=O)=O
Sequence	Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)
Sequence Short	ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29)

Storage & Solubility Information

Storage

keep away from moisture | store at -20°C | Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc