Your shopping cart is currently empty

Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more.


| Description | Defensin HNP-1, human acetate is an antimicrobial peptide and human α -defensin found mainly in neutrophils with broad-spectrum antimicrobial activity against bacteria and viruses, triggers NF-κB and IRF1 thereby increasing IFN-α, induces apoptosis in tumor cells, inhibits vascular endothelial cell function, mediates immunity to infections and more. |
| In vitro | Defensin HNP-1, human acetate (2.5 μg/mL for 48 h) inhibits the growth of human ovarian cancer cell line SKOV3 and induces apoptosis, likely through cell cycle arrest and activation of pro-apoptotic proteins such as caspase-3. Defensin HNP-1, human acetate has also been shown to sensitize cancer cells to chemotherapeutic agents like paclitaxel[1]. |
| In vivo | In vivo, in a xenograft model using nude mice (subcutaneous SKOV3 tumors), Defensin HNP-1, human acetate (10 μg/mouse, intraperitoneally, three times per week for 3 weeks) significantly suppressed tumor volume compared to control (P<0.05)[1]. |
| Synonyms | Defensin HNP-1, human acetate(99287-08-8 Free base) |
| Molecular Weight | 3508.13 |
| Formula | C152H232N44O40S6 |
| Smiles | OC(C)=O.OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H]([C@H](O)C)NC(CNC([C@@H](NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(O)=O)NC(CNC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@H](CS)NC([C@H](C)NC([C@H]2N(CCC2)C([C@H]([C@@H](C)CC)NC([C@H](CCCNC(N)=N)NC([C@H](CS)NC([C@@H](NC([C@H](CS)NC([C@@H](N)C)=O)=O)CC3=CC=C(C=C3)O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC4=CC=C(C=C4)O)=O)=O)=O)=O)=O)C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N[C@@H](CS)C(N[C@@H](CS)C(O)=O)=O)=O)CC5=CC=CC=C5)=O)=O)CC6=CNC7=CC=CC=C67)=O)=O)=O)=O)=O |
| Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Sequence Short | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Storage | Keep away from moisture | Store at -20°C | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.