Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cn2 toxin, a β-toxin, interacts with the voltage-sensing domain of voltage-gated sodium channels (NaV) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Cn2 toxin, a β-toxin, interacts with the voltage-sensing domain of voltage-gated sodium channels (NaV) [1]. |
Synonyms | β-Mammal toxin Cn2 |
Sequence | Lys-Glu-Gly-Tyr-Leu-Val-Asp-Lys-Asn-Thr-Gly-Cys-Lys-Tyr-Glu-Cys-Leu-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Lys-Gln-Gln-Tyr-Gly-Lys-Gly-Ala-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Ala-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Ile-Val-Trp-Pro-Leu-Pro-Asn-Lys-Arg |
Sequence Short | KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.