Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cecropin D, an antimicrobial peptide, exhibits a minimum inhibitory concentration (MIC) of 4.55 μg/mL and demonstrates efficacy against both Gram-negative and Gram-positive bacteria. Additionally, it possesses antiviral, antifungal, antitumor, and immunomodulatory properties [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Cecropin D, an antimicrobial peptide, exhibits a minimum inhibitory concentration (MIC) of 4.55 μg/mL and demonstrates efficacy against both Gram-negative and Gram-positive bacteria. Additionally, it possesses antiviral, antifungal, antitumor, and immunomodulatory properties [1] [2]. |
Molecular Weight | 4043.59 |
Formula | C180H293N55O51 |
Cas No. | 83652-32-8 |
Sequence | Trp-Asn-Pro-Phe-Lys-Glu-Leu-Glu-Lys-Val-Gly-Gln-Arg-Val-Arg-Asp-Ala-Val-Ile-Ser-Ala-Gly-Pro-Ala-Val-Ala-Thr-Val-Ala-Gln-Ala-Thr-Ala-Leu-Ala-Lys-Asn-His-NH2 |
Sequence Short | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.