Shopping Cart
- Remove All
Your shopping cart is currently empty
CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide derived from rabbit granulocytes, exhibiting extensive antimicrobial activity against both Gram-positive [IC50, 130-200 nM] and Gram-negative bacteria [IC50, 20-100 nM]. CAP18 (rabbit) holds promise for the study and advancement of bacterial sepsis research.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 100 mg | Inquiry | Backorder | |
| 500 mg | Inquiry | Backorder |
| Description | CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide derived from rabbit granulocytes, exhibiting extensive antimicrobial activity against both Gram-positive [IC50, 130-200 nM] and Gram-negative bacteria [IC50, 20-100 nM]. CAP18 (rabbit) holds promise for the study and advancement of bacterial sepsis research. |
| Targets&IC50 | Gram-negative bacteria:20-100 nM (IC50), Gram-positive bacteria:130-200 nM (IC50) |
| Synonyms | CAP18 (rabbit) |
| Cas No. | 152742-15-9 |
| Sequence Short | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.