Your shopping cart is currently empty

CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide derived from rabbit granulocytes, exhibiting extensive antimicrobial activity against both Gram-positive [IC50, 130-200 nM] and Gram-negative bacteria [IC50, 20-100 nM]. CAP18 (rabbit) holds promise for the study and advancement of bacterial sepsis research.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | CAP18 (rabbit) is a 37-amino-acid antimicrobial peptide derived from rabbit granulocytes, exhibiting extensive antimicrobial activity against both Gram-positive [IC50, 130-200 nM] and Gram-negative bacteria [IC50, 20-100 nM]. CAP18 (rabbit) holds promise for the study and advancement of bacterial sepsis research. |
| Targets&IC50 | Gram-positive bacteria:130-200 nM (IC50), Gram-negative bacteria:20-100 nM (IC50) |
| Synonyms | CAP18 (rabbit) |
| Cas No. | 152742-15-9 |
| Sequence | Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr |
| Sequence Short | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.