Shopping Cart
Remove All
Your shopping cart is currently empty
Anthopleurin-A, a sodium channel toxin, is selective for cardiac channels and has a cardiotonic effect. It can be isolated from the sea anemone [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Anthopleurin-A, a sodium channel toxin, is selective for cardiac channels and has a cardiotonic effect. It can be isolated from the sea anemone [1] [2]. |
| In vitro | Anthopleurin-A (2 nM-640 nM) increases the contractile force of isolated feline papillary muscles [2]. |
| In vivo | Intravenous administration of Anthopleurin-A (0.2 μg/kg/min) enhances myocardial contractility in anesthetized dogs [2]. |
| Molecular Weight | 5131.72 |
| Formula | C220H326N64O67S6 |
| Cas No. | 60880-63-9 |
| Sequence | Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47) |
| Sequence Short | GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.