Shopping Cart
- Remove All
- Your shopping cart is currently empty
Abaecin, an antibacterial peptide, exhibits selective efficacy against an Apidaecin-resistant strain of Xanthomonas [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Abaecin, an antibacterial peptide, exhibits selective efficacy against an Apidaecin-resistant strain of Xanthomonas [1]. |
Molecular Weight | 3878.44 |
Formula | C187H270N48O43 |
Cas No. | 123997-18-2 |
Sequence | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
Sequence Short | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.