Shopping Cart
- Remove All
- Your shopping cart is currently empty
Abaecin acetate is a proline-enriched cationic peptide with broad-spectrum antimicrobial activity derived from the honeybee Apis mellifera.Abaecin acetate inhibits the growth of Escherichia coli in vitro.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $195 | In Stock | |
5 mg | $483 | In Stock | |
10 mg | $692 | In Stock | |
25 mg | $1,080 | In Stock |
Description | Abaecin acetate is a proline-enriched cationic peptide with broad-spectrum antimicrobial activity derived from the honeybee Apis mellifera.Abaecin acetate inhibits the growth of Escherichia coli in vitro. |
Synonyms | Abaecin acetate(123997-18-2 Free base) |
Color | White |
Appearance | Solid |
Sequence | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
Sequence Short | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.