Shopping Cart
- Remove All
- Your shopping cart is currently empty
Highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | TBD | 35 days |
Description | Highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD. |
Molecular Weight | 4983.58 |
Formula | C226H338N60O66S |
Cas No. | 444073-04-5 |
Relative Density. | no data available |
Sequence | Tyr-{d-Ala}-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
Sequence Short | Y-{d-Ala}-EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.2 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.