Shopping Cart
- Remove All
- Your shopping cart is currently empty
β-Endorphin, rat (β-Lipotropin 61-91), is a neuropeptide involved in cardiovascular regulation and induces significant, lasting muscular rigidity and immobility similar to catatonia in rats [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | β-Endorphin, rat (β-Lipotropin 61-91), is a neuropeptide involved in cardiovascular regulation and induces significant, lasting muscular rigidity and immobility similar to catatonia in rats [1] [2]. |
Alias | β-Lipotropin 61-91 |
Molecular Weight | 3437.96 |
Formula | C155H250N42O44S |
Cas No. | 59887-17-1 |
Sequence | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
Sequence Short | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.