Shopping Cart
- Remove All
- Your shopping cart is currently empty
Urotoxin selectively inhibits the hKv1.2 potassium channel, showcasing a specific affinity for this subtype [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Urotoxin selectively inhibits the hKv1.2 potassium channel, showcasing a specific affinity for this subtype [1]. |
Synonyms | α-KTx 6.21 |
Sequence | Gly-Asp-Ile-Lys-Cys-Ser-Gly-Thr-Arg-Gln-Cys-Trp-Gly-Pro-Cys-Lys-Lys-Gln-Thr-Thr-Cys-Thr-Asn-Ser-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Gly-Cys-Val-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36) |
Sequence Short | GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.