Your shopping cart is currently empty

Tat-peptide 190-208 is a Tat-tagged cell-penetrating fusion peptide that corresponds to residues 190-208 of rat G3BP1. The Tat sequence from HIV, positioned at the least conserved end of the sequence, facilitates cell permeability. Tat-peptide 190-208 enhances axonal growth and increases the number of axons per neuron, potentially demonstrating intrinsic axonal mechanisms. It may also be employed for ischemic protection during endovascular repair of intracranial aneurysms.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-peptide 190-208 is a Tat-tagged cell-penetrating fusion peptide that corresponds to residues 190-208 of rat G3BP1. The Tat sequence from HIV, positioned at the least conserved end of the sequence, facilitates cell permeability. Tat-peptide 190-208 enhances axonal growth and increases the number of axons per neuron, potentially demonstrating intrinsic axonal mechanisms. It may also be employed for ischemic protection during endovascular repair of intracranial aneurysms. |
| In vitro | Tat-peptide 190-208, when applied at concentrations of 10 μM and 20 μM for 24 hours, enhances axon length in isolated DRG cultures at 10 μM and in iMotor neurons at 20 μM. Additionally, a 10 μM concentration of Tat-peptide 190-208 over 3 days increases the total number of axons extending from each neuron. |
| Formula | C142H214N40O57 |
| Sequence | Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn-Val-Ala-Glu-Pro-Glu-Pro-Asp-Pro-Glu-Pro-Glu-Pro-Glu-Gln-Glu-Pro-Val-Ser-Glu |
| Sequence Short | YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.