Your shopping cart is currently empty

Tat-peptide 190-208 TFA is a Tat-labeled, cell-permeable fusion peptide derived from residues 190-208 of rat G3BP1. The HIV-derived Tat sequence at the peptide's least conserved region confers cellular permeability. This compound promotes axon growth and enhances neurite formation per neuron, suggesting an axon intrinsic mechanism of action. Additionally, it has potential applications in providing ischemic protection during endovascular repair of intracranial aneurysms [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-peptide 190-208 TFA is a Tat-labeled, cell-permeable fusion peptide derived from residues 190-208 of rat G3BP1. The HIV-derived Tat sequence at the peptide's least conserved region confers cellular permeability. This compound promotes axon growth and enhances neurite formation per neuron, suggesting an axon intrinsic mechanism of action. Additionally, it has potential applications in providing ischemic protection during endovascular repair of intracranial aneurysms [1]. |
| In vitro | Tat-peptide 190-208 TFA at concentrations of 10 μM and 20 μM administered for 24 hours increased axonal length in isolated DRG cultures and the iMotor neurons, respectively [1]. Additionally, a 10 μM dose of Tat-peptide 190-208 TFA over a 3-day period increased the total number of axons extending from each neuron [1]. |
| Molecular Weight | 3507.47 |
| Formula | C142H214N40O57.C2HF3O2 |
| Sequence | Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn-Val-Ala-Glu-Pro-Glu-Pro-Asp-Pro-Glu-Pro-Glu-Pro-Glu-Gln-Glu-Pro-Val-Ser-Glu |
| Sequence Short | YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.