Shopping Cart
- Remove All
- Your shopping cart is currently empty
SpHistin, an antimicrobial peptide (AMP), binds to lipopolysaccharide (LPS) and permeabilizes the bacterial membrane. In combination with Rifampicin and Azithromycin, it facilitates increased intracellular uptake of these antibiotics, thereby enhancing their collective bactericidal efficacy against Pseudomonas aeruginosa [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | SpHistin, an antimicrobial peptide (AMP), binds to lipopolysaccharide (LPS) and permeabilizes the bacterial membrane. In combination with Rifampicin and Azithromycin, it facilitates increased intracellular uptake of these antibiotics, thereby enhancing their collective bactericidal efficacy against Pseudomonas aeruginosa [1]. |
Molecular Weight | 3943.59 |
Formula | C170H293N61O45S |
Sequence | Met-Ala-Gly-Gly-Lys-Ala-Gly-Lys-Asp-Ser-Gly-Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys |
Sequence Short | MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.