Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Sortase A, S. aureus (Synonyms: SrtA)

Catalog No. TRP-00383 Copy Product Info
🥰Excellent
Sortase A, S. aureus (SrtA) is found in many Gram-positive bacteria and facilitates the recruitment of cell surface proteins. It plays a crucial role in the attachment of various molecules on the cell surface.

Sortase A, S. aureus

Copy Product Info
🥰Excellent
Catalog No. TRP-00383
Synonyms SrtA

Sortase A, S. aureus (SrtA) is found in many Gram-positive bacteria and facilitates the recruitment of cell surface proteins. It plays a crucial role in the attachment of various molecules on the cell surface.

Sortase A, S. aureus
Cas No. 9033-39-0
Pack SizePriceUSA StockGlobal StockQuantity
10 mgInquiryInquiryInquiry
50 mgInquiryInquiryInquiry
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Resource Download

Product Introduction

Bioactivity
Description
Sortase A, S. aureus (SrtA) is found in many Gram-positive bacteria and facilitates the recruitment of cell surface proteins. It plays a crucial role in the attachment of various molecules on the cell surface.
In vitro
The product can be diluted with sterile purified water to a concentration of 0.5 μg/μL for use. Peptide reaction system preparation (30 μL system) includes: Test group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 5 μL Sortase A (0.5 μg/μL), 10 μL 3× reaction Buffer, and 5 μL ddH2O; Control group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 20 μL ddH2O. Prepare the corresponding control and test groups as per the table, mix the test group reagents evenly, centrifuge, and react at 30°C for 1-3 hours. After the reaction, synchronize SDS-PAGE electrophoresis for both groups. Notes: 3× reaction Buffer consists of 100 mM Tris-HCl 7.5, 50 mM CaCl2, and 20 mM DTT. The synthetic peptides used for the performance reaction are as follows: SrtA-3 YGVRLCGREFIRAVIFTCGGSRWRRKGGLPRTGG (34) and SrtA-4 GGGGSGGRRSRRSRQDLQTLCCTDGCSMTDLSALC (35). When synthesizing peptides, it is recommended to divide them into small tubes and dissolve them in sterile purified water, preparing and using them immediately.
SynonymsSrtA
Chemical Properties
Cas No.9033-39-0
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year

Citations

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy Sortase A, S. aureus | purchase Sortase A, S. aureus | Sortase A, S. aureus cost | order Sortase A, S. aureus | Sortase A, S. aureus in vitro