Your shopping cart is currently empty

Sortase A, S. aureus (SrtA) is found in many Gram-positive bacteria and facilitates the recruitment of cell surface proteins. It plays a crucial role in the attachment of various molecules on the cell surface.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Sortase A, S. aureus (SrtA) is found in many Gram-positive bacteria and facilitates the recruitment of cell surface proteins. It plays a crucial role in the attachment of various molecules on the cell surface. |
| In vitro | The product can be diluted with sterile purified water to a concentration of 0.5 μg/μL for use. Peptide reaction system preparation (30 μL system) includes: Test group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 5 μL Sortase A (0.5 μg/μL), 10 μL 3× reaction Buffer, and 5 μL ddH2O; Control group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 20 μL ddH2O. Prepare the corresponding control and test groups as per the table, mix the test group reagents evenly, centrifuge, and react at 30°C for 1-3 hours. After the reaction, synchronize SDS-PAGE electrophoresis for both groups. Notes: 3× reaction Buffer consists of 100 mM Tris-HCl 7.5, 50 mM CaCl2, and 20 mM DTT. The synthetic peptides used for the performance reaction are as follows: SrtA-3 YGVRLCGREFIRAVIFTCGGSRWRRKGGLPRTGG (34) and SrtA-4 GGGGSGGRRSRRSRQDLQTLCCTDGCSMTDLSALC (35). When synthesizing peptides, it is recommended to divide them into small tubes and dissolve them in sterile purified water, preparing and using them immediately. |
| Synonyms | SrtA |
| Cas No. | 9033-39-0 |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.