Shopping Cart
- Remove All
- Your shopping cart is currently empty
Scyllatoxin (Leiurotoxin I), a peptide toxin derived from the venom of the scorpion (Leiurus quinquestriatus hebraeus), acts as a blocker of small-conductance K Ca (SK) channels. It notably enhances the release of norepinephrine (NE) and epinephrine (Epi) in vivo [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Scyllatoxin (Leiurotoxin I), a peptide toxin derived from the venom of the scorpion (Leiurus quinquestriatus hebraeus), acts as a blocker of small-conductance K Ca (SK) channels. It notably enhances the release of norepinephrine (NE) and epinephrine (Epi) in vivo [1]. |
Molecular Weight | 3423.15 |
Formula | C142H237N45O39S7 |
Cas No. | 142948-19-4 |
Sequence Short | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.