Your shopping cart is currently empty

RCP168 is a highly selective and potent CXCR4 receptor antagonist with an IC50 of 5 nM. It exhibits superior capacity to inhibit HIV-1 (Human Immunodeficiency Virus type 1) from entering host cells via the CXCR4 receptor compared to natural chemokines. RCP168 suppresses HIV-1 infection by blocking viral binding sites or inducing receptor internalization. It can be utilized in research to study interactions between the CXCR4 receptor and other chemokine receptors.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | RCP168 is a highly selective and potent CXCR4 receptor antagonist with an IC50 of 5 nM. It exhibits superior capacity to inhibit HIV-1 (Human Immunodeficiency Virus type 1) from entering host cells via the CXCR4 receptor compared to natural chemokines. RCP168 suppresses HIV-1 infection by blocking viral binding sites or inducing receptor internalization. It can be utilized in research to study interactions between the CXCR4 receptor and other chemokine receptors. |
| Targets&IC50 | CXCR4:5 nM |
| Formula | C365H585N105O95S5 |
| Sequence | d-(Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys)-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro-Gln-Val-Leu-Leu-Ser-Ser-Trp-Tyr-Pro-Thr-Ser-Gln-Leu-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Val-Cys-Ala-Asp-Lys-Ser-Lys-Asp-Trp-Val-Lys-Lys-Leu-Met-Gln-Gln-Leu-Pro-Val-Thr-Ala-Arg (Disulfide bridge: Cys11-Cys35,Cys12-Cys51) |
| Sequence Short | d-(LGASWHRPDK)-CCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR (Disulfide bridge: Cys11-Cys35,Cys12-Cys51) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.