RCP168

Name: RCP168
Brand: TargetMol
SKU: TP3593
Rating: 4.5 (1 reviews)

😃Good

Catalog No. TP3593

RCP168 is a highly selective and potent CXCR4 receptor antagonist with an IC50 of 5 nM. It exhibits superior capacity to inhibit HIV-1 (Human Immunodeficiency Virus type 1) from entering host cells via the CXCR4 receptor compared to natural chemokines. RCP168 suppresses HIV-1 infection by blocking viral binding sites or inducing receptor internalization. It can be utilized in research to study interactions between the CXCR4 receptor and other chemokine receptors.

RCP168

😃Good

Catalog No. TP3593

Pack Size	Price	USA Warehouse	Global Warehouse	Quantity
10 mg	Inquiry	Inquiry	Inquiry
50 mg	Inquiry	Inquiry	Inquiry

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description

Targets&IC50

CXCR4:5 nM

Chemical Properties

Formula	C₃₆₅H₅₈₅N₁₀₅O₉₅S₅
Sequence	d-(Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys)-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro-Gln-Val-Leu-Leu-Ser-Ser-Trp-Tyr-Pro-Thr-Ser-Gln-Leu-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Val-Cys-Ala-Asp-Lys-Ser-Lys-Asp-Trp-Val-Lys-Lys-Leu-Met-Gln-Gln-Leu-Pro-Val-Thr-Ala-Arg (Disulfide bridge: Cys11-Cys35,Cys12-Cys51)
Sequence Short	d-(LGASWHRPDK)-CCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR (Disulfide bridge: Cys11-Cys35,Cys12-Cys51)

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc