Shopping Cart
- Remove All
- Your shopping cart is currently empty
PP113 is an antimicrobial peptide with activity against both Gram-negative and Gram-positive bacteria, exhibiting minimum inhibitory concentrations (MICs) of 73.3 µM for E. coli, 23.3 µM for B. subtilis, 13 µM for S. aureus, 16.7 µM for S. lutea, and 23.3 µM for B. pumilus [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PP113 is an antimicrobial peptide with activity against both Gram-negative and Gram-positive bacteria, exhibiting minimum inhibitory concentrations (MICs) of 73.3 µM for E. coli, 23.3 µM for B. subtilis, 13 µM for S. aureus, 16.7 µM for S. lutea, and 23.3 µM for B. pumilus [1]. |
Molecular Weight | 5046.71 |
Formula | C229H355N71O59 |
Sequence | Gly-Lys-Trp-Gly-Trp-Ile-Tyr-Ile-Thr-Ile-Leu-Phe-Ala-Asp-Val-Gly-Gly-Phe-Lys-Ser-Ser-Arg-His-Pro-Glu-Glu-Arg-Arg-Val-Gln-Glu-Arg-Arg-Phe-Lys-Arg-Ile-Thr-Arg-Gly-Pro-Asp |
Sequence Short | GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.