Shopping Cart
- Remove All
Your shopping cart is currently empty
Plectasin
😃Good
Catalog No. TP2864
Plectasin, a peptide antibiotic derived from saprophytic fungi, can effectively kill Streptococcus pneumoniae in vitro. Additionally, it alleviates experimental peritonitis and pneumonia caused by Streptococcus pneumoniae in mice.
Plectasin
Plectasin
😃Good
Catalog No. TP2864
Plectasin, a peptide antibiotic derived from saprophytic fungi, can effectively kill Streptococcus pneumoniae in vitro. Additionally, it alleviates experimental peritonitis and pneumonia caused by Streptococcus pneumoniae in mice.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 10 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View MoreResource Download
Product Introduction
Bioactivity
Chemical Properties
| Description | Plectasin, a peptide antibiotic derived from saprophytic fungi, can effectively kill Streptococcus pneumoniae in vitro. Additionally, it alleviates experimental peritonitis and pneumonia caused by Streptococcus pneumoniae in mice. |
| Molecular Weight | 4401.92 |
| Formula | C189H267N53O56S7 |
| Sequence | Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39) |
| Sequence Short | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39) |
Storage & Solubility Information
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . A total of 10 animals were administered, and the formula you used is 5% 
DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.Preparation method for in vivo formula: Take 50 μL DMSO main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarify
main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2O mix well and clarifyFor Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Sci Citations
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy Plectasin | purchase Plectasin | Plectasin cost | order Plectasin | Plectasin formula | Plectasin molecular weight
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.