Shopping Cart
- Remove All
Your shopping cart is currently empty
PKC fragment (530-558) is a peptide fragment of protein kinase C (PKC) and is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $155 | Backorder |
| Description | PKC fragment (530-558) is a peptide fragment of protein kinase C (PKC) and is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption. |
| Molecular Weight | 3354.71 |
| Formula | C148H221N35O50S2 |
| Cas No. | 122613-29-0 |
| Sequence Short | LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.