Shopping Cart
- Remove All
- Your shopping cart is currently empty
PEP1 is a biologically active peptide that interacts with POPC supported lipid bilayers (SLBs), binding at low concentrations, while higher concentrations induce POPC SLB lysis.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PEP1 is a biologically active peptide that interacts with POPC supported lipid bilayers (SLBs), binding at low concentrations, while higher concentrations induce POPC SLB lysis. |
Sequence | Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2 |
Sequence Short | SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.