Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pediocin PA 1 TFA is a broad-spectrum bacteriocin produced by lactic acid bacteria, inhibiting the activity of foodborne pathogens such as Listeria monocytogenes and other Gram-positive bacteria. It has applications as a biopreservative in food products.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Pediocin PA 1 TFA is a broad-spectrum bacteriocin produced by lactic acid bacteria, inhibiting the activity of foodborne pathogens such as Listeria monocytogenes and other Gram-positive bacteria. It has applications as a biopreservative in food products. |
Molecular Weight | 4624.12 (free base) |
Formula | C196H293N61O60S5.xC2HF3O2 |
Sequence | Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44) |
Sequence Short | KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.