Shopping Cart
- Remove All
Your shopping cart is currently empty
Pardaxin P5, an antimicrobial peptide, inhibits Escherichia coli at a minimum inhibitory concentration (MIC) of 13 μM [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Pardaxin P5, an antimicrobial peptide, inhibits Escherichia coli at a minimum inhibitory concentration (MIC) of 13 μM [1]. |
| Molecular Weight | 3381.87 |
| Formula | C156H250N36O47 |
| Cas No. | 67995-63-5 |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu |
| Sequence Short | GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.