Shopping Cart
- Remove All
- Your shopping cart is currently empty
LCI peptide exhibits antimicrobial and antibacterial properties, effectively targeting plant pathogens such as Xanthomonas and Pseudomonas, as well as combating E. coli, Gentamicin-resistant MRSA, and Xoo [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | LCI peptide exhibits antimicrobial and antibacterial properties, effectively targeting plant pathogens such as Xanthomonas and Pseudomonas, as well as combating E. coli, Gentamicin-resistant MRSA, and Xoo [1]. |
Molecular Weight | 5464.15 |
Formula | C259H378N62O69 |
Sequence | Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys |
Sequence Short | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.