Shopping Cart
- Remove All
- Your shopping cart is currently empty
Kisspeptin-54(human) TFA, also known as Metastin(human) TFA, is the natural ligand for the kisspeptin receptor (KISS1, GPR54). It demonstrates high affinity for both rat and human GPR54 receptors with dissociation constants (K i) of 1.81 nM and 1.45 nM, respectively. This compound plays a crucial role in inhibiting tumor metastasis and promoting the secretion of gonadotropins, as evidenced by references [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Kisspeptin-54(human) TFA, also known as Metastin(human) TFA, is the natural ligand for the kisspeptin receptor (KISS1, GPR54). It demonstrates high affinity for both rat and human GPR54 receptors with dissociation constants (K i) of 1.81 nM and 1.45 nM, respectively. This compound plays a crucial role in inhibiting tumor metastasis and promoting the secretion of gonadotropins, as evidenced by references [1] [2]. |
Molecular Weight | 5971.45 |
Formula | C258H401N79O78.C2HF3O2 |
Sequence | Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
Sequence Short | GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.