Shopping Cart
- Remove All
- Your shopping cart is currently empty
Kaliotoxin (1-37), a toxin derived from the scorpion Androctonus mauretanicus mauretanicus, acts as a potent blocker of calcium-dependent potassium channels [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Kaliotoxin (1-37), a toxin derived from the scorpion Androctonus mauretanicus mauretanicus, acts as a potent blocker of calcium-dependent potassium channels [1]. |
Molecular Weight | 4018.82 |
Formula | C165H271N53O48S8 |
Cas No. | 150769-72-5 |
Sequence Short | GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTP (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.