Shopping Cart
- Remove All
Your shopping cart is currently empty
Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.Growth hormone-releasing hormone is a hormone produced in the hypothalamus. The main role of growth hormone-releasing hormone is to stimulate the pituitary gland to produce and release growth hormone into the bloodstream.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $216 | Backorder | |
| 5 mg | $765 | Backorder | |
| 10 mg | $1,188 | Backorder |
| Description | Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.Growth hormone-releasing hormone is a hormone produced in the hypothalamus. The main role of growth hormone-releasing hormone is to stimulate the pituitary gland to produce and release growth hormone into the bloodstream. |
| Synonyms | Growth Hormone Releasing Factor human |
| Molecular Weight | 5039.65 |
| Formula | C215H358N72O66S |
| Cas No. | 83930-13-6 |
| Relative Density. | no data available |
| Sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
| Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | H2O: 25 mg/mL (4.96 mM), Sonication and heating are recommended. | ||||||||||
Solution Preparation Table | |||||||||||
H2O
| |||||||||||

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.