Your shopping cart is currently empty

Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.Growth hormone-releasing hormone is a hormone produced in the hypothalamus. The main role of growth hormone-releasing hormone is to stimulate the pituitary gland to produce and release growth hormone into the bloodstream.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $216 | Inquiry | Inquiry | |
| 5 mg | $765 | Inquiry | Inquiry | |
| 10 mg | $1,188 | Inquiry | Inquiry |
| Description | Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.Growth hormone-releasing hormone is a hormone produced in the hypothalamus. The main role of growth hormone-releasing hormone is to stimulate the pituitary gland to produce and release growth hormone into the bloodstream. |
| Synonyms | Growth Hormone Releasing Factor human |
| Molecular Weight | 5039.65 |
| Formula | C215H358N72O66S |
| Cas No. | 83930-13-6 |
| Relative Density. | no data available |
| Sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
| Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | H2O: 25 mg/mL (4.96 mM), Sonication and heating are recommended. | ||||||||||
Solution Preparation Table | |||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.