Shopping Cart
- Remove All
- Your shopping cart is currently empty
Hispidalin, a novel antimicrobial peptide, exhibits broad and efficient antibacterial and antifungal properties against diverse pathogens, making it an effective antibacterial agent and food preservative [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Hispidalin, a novel antimicrobial peptide, exhibits broad and efficient antibacterial and antifungal properties against diverse pathogens, making it an effective antibacterial agent and food preservative [1]. |
Molecular Weight | 5700.17 |
Formula | C255H378N72O78 |
Cas No. | 2243219-67-0 |
Sequence | Ser-Asp-Tyr-Leu-Asn-Asn-Asn-Pro-Leu-Phe-Pro-Arg-Tyr-Asp-Ile-Gly-Asn-Val-Glu-Leu-Ser-Thr-Ala-Tyr-Arg-Ser-Phe-Ala-Asn-Gln-Lys-Ala-Pro-Gly-Arg-Leu-Asn-Gln-Asn-Trp-Ala-Leu-Thr-Ala-Asp-Tyr-Thr-Tyr-Arg |
Sequence Short | SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.