Shopping Cart
- Remove All
- Your shopping cart is currently empty
GsAF-II is a peptide toxin that selectively blocks hERG1 subtype potassium channels through a voltage-dependent mechanism and impedes Nav1.x subtype sodium channels [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GsAF-II is a peptide toxin that selectively blocks hERG1 subtype potassium channels through a voltage-dependent mechanism and impedes Nav1.x subtype sodium channels [1]. |
Molecular Weight | 3979.7 |
Formula | C176H261N47O45S7 |
Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Ile-Glu-Trp (Disulfide bonds: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
Sequence Short | YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW (Disulfide bonds: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.