Shopping Cart
- Remove All
- Your shopping cart is currently empty
GHRF (mouse), a mouse growth hormone-releasing factor, is a 44-amino acid peptide that promotes the synthesis and release of growth hormone [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GHRF (mouse), a mouse growth hormone-releasing factor, is a 44-amino acid peptide that promotes the synthesis and release of growth hormone [1]. |
In vivo | GHRF administration in mice (40 μg/kg, IP, single dose) significantly elevates growth hormone levels in LI-IGF-I knockout mice [1]. |
Synonyms | Mouse growth hormone-releasing factor |
Cas No. | 125199-49-7 |
Sequence Short | HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.