Shopping Cart
- Remove All
- Your shopping cart is currently empty
Garvicin KS is a 32-amino-acid peptide that, in collaboration with two other peptides, GakA and GakB, constitutes the bacteriocin GarKS. This compound impairs fibroblast viability and proliferation and exhibits antimicrobial activity against MSSA, demonstrating minimum inhibitory concentration (MIC) values ranked as GakB > GakC > GakA [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Garvicin KS is a 32-amino-acid peptide that, in collaboration with two other peptides, GakA and GakB, constitutes the bacteriocin GarKS. This compound impairs fibroblast viability and proliferation and exhibits antimicrobial activity against MSSA, demonstrating minimum inhibitory concentration (MIC) values ranked as GakB > GakC > GakA [1]. |
Molecular Weight | 3099.73 |
Formula | C143H240N38O36S |
Cas No. | 2098351-26-7 |
Sequence | Met-Gly-Ala-Ile-Ile-Lys-Ala-Gly-Ala-Lys-Ile-Val-Gly-Lys-Gly-Ala-Leu-Thr-Gly-Gly-Gly-Val-Trp-Leu-Ala-Glu-Lys-Leu-Phe-Gly-Gly-Lys |
Sequence Short | MGAIIKAGAKIVGKGALTGGGVWLAEKLFGGK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.