Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FOXO4-DRI

😃Good
Catalog No. T76563Cas No. 2460055-10-9

FOXO4-DRI, a cell-permeable peptide antagonist, inhibits the interaction between FOXO4 and p53. It functions as a senolytic peptide, promoting apoptosis in senescent cells [1].

FOXO4-DRI

FOXO4-DRI

😃Good
Catalog No. T76563Cas No. 2460055-10-9
FOXO4-DRI, a cell-permeable peptide antagonist, inhibits the interaction between FOXO4 and p53. It functions as a senolytic peptide, promoting apoptosis in senescent cells [1].
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 mgInquiryInquiryInquiry
50 mgInquiryInquiryInquiry
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
With extensive experience in compound synthesis, we can provide rapid custom synthesis services for this product according to your research needs.All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
TargetMol
View More

Resource Download

Product Introduction

Bioactivity
Description
FOXO4-DRI, a cell-permeable peptide antagonist, inhibits the interaction between FOXO4 and p53. It functions as a senolytic peptide, promoting apoptosis in senescent cells [1].
Chemical Properties
Molecular Weight5358.06
FormulaC228H388N86O64
Cas No.2460055-10-9
SequenceD-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)
Sequence ShortD-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Storage & Solubility Information
Storagekeep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy FOXO4-DRI | purchase FOXO4-DRI | FOXO4-DRI cost | order FOXO4-DRI | FOXO4-DRI formula | FOXO4-DRI molecular weight