Shopping Cart
- Remove All
- Your shopping cart is currently empty
FOXO4-DRI, a cell-permeable peptide antagonist, inhibits the interaction between FOXO4 and p53. It functions as a senolytic peptide, promoting apoptosis in senescent cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | FOXO4-DRI, a cell-permeable peptide antagonist, inhibits the interaction between FOXO4 and p53. It functions as a senolytic peptide, promoting apoptosis in senescent cells [1]. |
Molecular Weight | 5358.06 |
Formula | C228H388N86O64 |
Cas No. | 2460055-10-9 |
Sequence | D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly) |
Sequence Short | D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.