Shopping Cart
- Remove All
- Your shopping cart is currently empty
Ergtoxin-1, a potassium channel blocker isolated from the venom of the Mexican scorpion Centruroides noxius, inhibits ERG-K+ channels in nerve, heart, and endocrine cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Ergtoxin-1, a potassium channel blocker isolated from the venom of the Mexican scorpion Centruroides noxius, inhibits ERG-K+ channels in nerve, heart, and endocrine cells [1]. |
Alias | ErgTx1 |
Cas No. | 304436-85-9 |
Sequence | Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41) |
Sequence Short | DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.