Your shopping cart is currently empty

Enterocin K1 (EntK1) is a ribosomally synthesized bacteriocin with potent antibacterial activity against Vancomycin-resistant Enterococcus (VRE), specifically targeting Enterococcus faecalis through interaction with the Eep protein on the bacterial membrane. The compound shows promise for research into VRE infections [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Enterocin K1 (EntK1) is a ribosomally synthesized bacteriocin with potent antibacterial activity against Vancomycin-resistant Enterococcus (VRE), specifically targeting Enterococcus faecalis through interaction with the Eep protein on the bacterial membrane. The compound shows promise for research into VRE infections [1]. |
| In vitro | Enterocin K1 exhibits antimicrobial activity with MIC (Minimum Inhibitory Concentration) values ranging from 0.048 to 1.56 mg/mL against various enterococci [1]. No significant hemolytic effect on human erythrocytes was observed with Enterocin K1 at concentrations of 0.01, 0.1, and 1 mg/mL in whole blood [1]. Additionally, Enterocin K1, at a concentration of 1 mg/mL over 0-48 hours, demonstrated an enhanced inhibitory effect on bacteriocins in plasma—twofold higher than in saline—and in whole blood—twofold higher than in plasma [1]. In the spot-on-lawn assay, Enterocin K1 (with 10 μl of 1 mg/mL over 24 hours) showed that most MIC values against bacteriocins were greater than 25 mg/mL, indicating cross-resistance [1]. |
| Synonyms | EntK1 |
| Molecular Weight | 4564.34 |
| Formula | C218H321N53O51S2 |
| Cas No. | 2764845-22-7 |
| Sequence | Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys |
| Sequence Short | MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.