Shopping Cart
Remove All
Your shopping cart is currently empty
Enterocin K1 (EntK1) is a ribosomally synthesized bacteriocin with potent antibacterial activity against Vancomycin-resistant Enterococcus (VRE), specifically targeting Enterococcus faecalis through interaction with the Eep protein on the bacterial membrane. The compound shows promise for research into VRE infections [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | Enterocin K1 (EntK1) is a ribosomally synthesized bacteriocin with potent antibacterial activity against Vancomycin-resistant Enterococcus (VRE), specifically targeting Enterococcus faecalis through interaction with the Eep protein on the bacterial membrane. The compound shows promise for research into VRE infections [1]. |
| In vitro | Enterocin K1 exhibits antimicrobial activity with MIC (Minimum Inhibitory Concentration) values ranging from 0.048 to 1.56 mg/mL against various enterococci [1]. No significant hemolytic effect on human erythrocytes was observed with Enterocin K1 at concentrations of 0.01, 0.1, and 1 mg/mL in whole blood [1]. Additionally, Enterocin K1, at a concentration of 1 mg/mL over 0-48 hours, demonstrated an enhanced inhibitory effect on bacteriocins in plasma—twofold higher than in saline—and in whole blood—twofold higher than in plasma [1]. In the spot-on-lawn assay, Enterocin K1 (with 10 μl of 1 mg/mL over 24 hours) showed that most MIC values against bacteriocins were greater than 25 mg/mL, indicating cross-resistance [1]. |
| Synonyms | EntK1 |
| Molecular Weight | 4564.34 |
| Formula | C218H321N53O51S2 |
| Cas No. | 2764845-22-7 |
| Sequence | Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys |
| Sequence Short | MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.