Shopping Cart
- Remove All
- Your shopping cart is currently empty
Enterocin Hybrid 1, an antibacterial agent, effectively inhibits Vancomycin-resistant Enterococcus faecium and Staphylococcus haemolyticus [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Enterocin Hybrid 1, an antibacterial agent, effectively inhibits Vancomycin-resistant Enterococcus faecium and Staphylococcus haemolyticus [1]. |
Alias | K1-EJ hybrid |
Molecular Weight | 4610.3 |
Formula | C218H323N55O54S |
Cas No. | 2764845-25-0 |
Sequence | Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Asn-Trp-Tyr-Lys-Gln-Gln-Tyr-Gly-Arg-Tyr-Pro-Trp-Glu-Arg-Pro-Val-Ala |
Sequence Short | MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.