Your shopping cart is currently empty

DN59 is a peptide composed of 33 amino acids that mimics the stem region of the dengue virus type 2 E protein. It is capable of inhibiting all four serotypes of the dengue virus (IC50: 2-5 μM) as well as other flaviviruses. DN59 exerts its antiviral activity by interacting directly with viral particles, leading to the release of genomic RNA.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | DN59 is a peptide composed of 33 amino acids that mimics the stem region of the dengue virus type 2 E protein. It is capable of inhibiting all four serotypes of the dengue virus (IC50: 2-5 μM) as well as other flaviviruses. DN59 exerts its antiviral activity by interacting directly with viral particles, leading to the release of genomic RNA. |
| Molecular Weight | 3443.92 |
| Formula | C161H240N38O44S |
| Cas No. | 869011-94-9 |
| Smiles | C([C@@H](C(N[C@H](C(N[C@@H](CC1=CC=CC=C1)C(NCC(N[C@H](C(N[C@H](C(NCC(NCC(N[C@H](C(N[C@@H](CC2=CC=CC=C2)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC3=CN=CN3)C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=CC=C4)C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC5=CC=C(O)C=C5)C(O)=O)=O)[C@H](CC)C)=O)C)=O)=O)=O)[C@H](C)C)=O)CCC(N)=O)=O)=O)CC(C)C)=O)C)=O)CCCCN)=O)=O)[C@H](CC)C)=O)CO)=O)[C@@H](C)O)=O)=O)[C@H](C)C)=O)=O)=O)CC(C)C)=O)CO)=O)=O)=O)CC(O)=O)=O)NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CCSC)N)=O)C)=O)[C@H](CC)C)=O)CC(C)C)=O)=O)CC(O)=O)=O)[C@@H](C)O)=O)C)=O)C=6C=7C(NC6)=CC=CC7 |
| Sequence | Met-Ala-Ile-Leu-Gly-Asp-Thr-Ala-Trp-Asp-Phe-Gly-Ser-Leu-Gly-Gly-Val-Phe-Thr-Ser-Ile-Gly-Lys-Ala-Leu-His-Gln-Val-Phe-Gly-Ala-Ile-Tyr |
| Sequence Short | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.